{"product_id":"proteintech-13780-1-ap","title":"Proteintech, 13780-1-AP, GNG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNG4 (13780-1-AP) by Proteintech is a Polyclonal antibody targeting GNG4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n13780-1-AP targets GNG4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW480 cells, mouse brain tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4787 Product name: Recombinant human GNG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC022485 Sequence: MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma 4\nCalculated Molecular Weight: 75 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC022485\nGene Symbol: GNG4\nGene ID (NCBI): 2786\nRRID: AB_2109909\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50150\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869408972969,"sku":"13780-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13780-1-ap","provider":"Iright","version":"1.0","type":"link"}