{"product_id":"proteintech-13781-1-ap","title":"Proteintech, 13781-1-AP, FABP6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FABP6 (13781-1-AP) by Proteintech is a Polyclonal antibody targeting FABP6 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n13781-1-AP targets FABP6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue, HepG2 cells\nPositive IHC detected in: human small intestine tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFatty acid binding protein 6 (FABP6, also known as the ileal bile acid binding protein IBABP) is regarded as a bile acid binding protein found in the distal portion of the small intestine and may be important in maintaining bile acid homeostasis(PMID: 25754072). FABP6 is reportedly up-regulated in colorectal cancer, it has been suggested as a link between bile acids and the risk of colorectal cancer(PMID: 17909007). And also, it was showed a potential drug target for the treatment of diabetes(PMID: 27500412). There are 2 isoforms of this protein,one of which is about 14 kDa we detected.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4788 Product name: Recombinant human FABP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC022489 Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Predict reactive species\nFull Name: fatty acid binding protein 6, ileal\nCalculated Molecular Weight: 177 aa, 20 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC022489\nGene Symbol: FABP6\nGene ID (NCBI): 2172\nRRID: AB_2877976\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51161\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868965818537,"sku":"13781-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13781-1-ap","provider":"Iright","version":"1.0","type":"link"}