{"product_id":"proteintech-13854-1-ap","title":"Proteintech, 13854-1-AP, SORBS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SORBS1 (13854-1-AP) by Proteintech is a Polyclonal antibody targeting SORBS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n13854-1-AP targets SORBS1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells,  HEK-293 cells,  mouse kidney tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe sorbin homology (SoHo) family of adapter and scaffold proteins consists of three proteins: CAP, also known as Sorbin and SH3 domain containing 1 (Sorbs1), ArgBP2, also known as Sorbs2, and Vinexin, also known as Sorbs3. All Sorbs proteins are highly expressed in heart tissue, skeletal muscle, adipose tissue, and cells of the immune system, functioning as SH3-domain-mediated adaptors of scaffolding molecules(PMID: 32738595). SORBS1 can bind to signaling molecules (e.g., c-Cbl, c-Abl, and insulin reporter) to regulate glucose transport, transcription activity, and insulin signaling(PMID: 27791200).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4828 Product name: Recombinant human SORBS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC042612 Sequence: MSSECDGGSKAVMNGLAPGSNGQDKDMDPTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPDEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDS Predict reactive species\nFull Name: sorbin and SH3 domain containing 1\nCalculated Molecular Weight: 1292 aa, 142 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC042612\nGene Symbol: SORBS1\nGene ID (NCBI): 10580\nRRID: AB_11232224\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BX66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989575337,"sku":"13854-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13854-1-ap","provider":"Iright","version":"1.0","type":"link"}