{"product_id":"proteintech-13898-1-ap","title":"Proteintech, 13898-1-AP, MAP2K3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP2K3 (13898-1-AP) by Proteintech is a Polyclonal antibody targeting MAP2K3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n13898-1-AP targets MAP2K3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse skeletal muscle tissue,  A549 cells,  THP-1 cells,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP2K3, also named MKK3, is a member of the dual specificity kinase group and serves as a specific activator of p38 MAPK with MKK6. MKK3 can be phosphorylated by cytokines and environmental stress at sites Ser189 and Thr193 by MKKK proteins (MEKK 1-4).  MKK3 plays a key role in cell differentiation, motility, division, and death. It has been reported that MKK3 targeting may represent an effective and potentially safe therapeutic strategy to selectively kill cancer cells in colorectal cancer patients. (PMID: 31695024, 30770795, 26805700, 8622669)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4861 Product name: Recombinant human MAP2K3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-347 aa of BC032478 Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS Predict reactive species\nFull Name: mitogen-activated protein kinase kinase 3\nCalculated Molecular Weight: 347 aa, 39 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC032478\nGene Symbol: MAP2K3\nGene ID (NCBI): 5606\nRRID: AB_10642959\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46734\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887955759273,"sku":"13898-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13898-1-ap","provider":"Iright","version":"1.0","type":"link"}