{"product_id":"proteintech-13915-1-ap","title":"Proteintech, 13915-1-AP, SPAG8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPAG8 (13915-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG8 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13915-1-AP targets SPAG8 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPAG8, also named as Sperm-associated antigen 8 or HSD-1, is a 426 amino acid protein, which is expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine. SPAG8 may play a role in fertility and microtubule formation through interaction with RANBP9. SPAG8 as testis-specific protein is produced during male germ cell differentiation and functions in a germ cell type- and stage-specific manner during spermatogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4910 Product name: Recombinant human SPAG8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC019247 Sequence: METNGSTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPGSSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVLNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKPPDIKGKLMVCYETLPRGQCLLYNWEEERATNHLDQVPSMQ Predict reactive species\nFull Name: sperm associated antigen 8\nCalculated Molecular Weight: 45 kDa, 54 kDa\nObserved Molecular Weight: 56-70 kDa\nGenBank Accession Number: BC019247\nGene Symbol: SPAG8\nGene ID (NCBI): 26206\nRRID: AB_2194804\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99932\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869604040873,"sku":"13915-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13915-1-ap","provider":"Iright","version":"1.0","type":"link"}