{"product_id":"proteintech-13942-1-ap","title":"Proteintech, 13942-1-AP, PGM2L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGM2L1 (13942-1-AP) by Proteintech is a Polyclonal antibody targeting PGM2L1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13942-1-AP targets PGM2L1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse skeletal muscle tissue,  mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGM2L1 (Phosphoglucomutase 2 Like 1) is an enzyme-like protein involved in carbohydrate metabolism. PGM2L1 catalyzes the formation of G16BP by using the glycolytic intermediate 1,3-bisphosphoglycerate as a phosphate donor and glucose-1-phosphate or glucose-6-phosphate as a phosphate acceptor. PGM2L1 plays a crucial role in glycogen metabolism, glycolysis, and gluconeogenesis as a key enzyme, and increasing evidence links its function to cancer metabolism and progression. While PGM2 has a wide tissue distribution, PGM2L1 is highly expressed in the brain, accounting for the elevated concentrations of glucose-1,6-bisphosphate found there (PMID: 33979636, PMID: 40027181).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5019 Product name: Recombinant human PGM2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-622 aa of BC059360 Sequence: GHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV Predict reactive species\nFull Name: phosphoglucomutase 2-like 1\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC059360\nGene Symbol: PGM2L1\nGene ID (NCBI): 283209\nRRID: AB_2299394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PCE3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869482504361,"sku":"13942-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13942-1-ap","provider":"Iright","version":"1.0","type":"link"}