{"product_id":"proteintech-13943-1-ap","title":"Proteintech, 13943-1-AP, SCNN1G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCNN1G (13943-1-AP) by Proteintech is a Polyclonal antibody targeting SCNN1G in IHC, ELISA applications with reactivity to human, mouse, rat samples\n13943-1-AP targets SCNN1G in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCNN1G (sodium channel, nonvoltage-gated 1, gamma), also known as ENaC gamma  (epithelial Na(+) channel subunit gamma) or amiloride-sensitive sodium channel subunit gamma, is the gamma subunit of the epithelial Na(+) channel (ENaC). ENaC is expressed in the apical membrane of salt-absorbing epithelia of kidney, distal colon, and lung. ENaC is a non-voltage gated, constitutively active channel highly selective for sodium. It has an essential role in salt and fluid homeostasis across epithelial tissues. Mutations in the gene of SCNN1G have been associated with Liddle syndrome. Native SCNN1G has a calculated molecular weight of 74 kDa and maybe undergo post-transcriptional modifications, including glycosylation and proteolytic cleavage (PMID: 12871941; 18086683).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5020 Product name: Recombinant human SCNN1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-401 aa of BC059391 Sequence: VHFRKLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQT Predict reactive species\nFull Name: sodium channel, nonvoltage-gated 1, gamma\nCalculated Molecular Weight: 74 kDa\nObserved Molecular Weight: 70-85 kDa\nGenBank Accession Number: BC059391\nGene Symbol: SCNN1G\nGene ID (NCBI): 6340\nRRID: AB_2184510\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51170\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936622249,"sku":"13943-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13943-1-ap","provider":"Iright","version":"1.0","type":"link"}