{"product_id":"proteintech-13951-1-ap","title":"Proteintech, 13951-1-AP, ALDH1A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH1A2 (13951-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1A2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13951-1-AP targets ALDH1A2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse spleen tissue,  mouse testis tissue,  rat spleen tissue,  rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALDH1A2(aldehyde dehydrogenase family 1 member A2) is also named as RALDH2(retinal dehydrogenase 2) and belongs to the aldehyde dehydrogenase family. It is a cytosolic homotetramer(56.7 kDa subunits) exhibiting complex expression patterns throughout embryonic development. ALDH1A2 plays a role in retinoid metabolism during embryonic development where it is considered to be the major retinoic acid-synthesizing enzyme during early embryogenesis(PMID:20735668). Its expression is reduced in primary prostate tumors compared with normal prostate tissue suggested that it is normally expressed in the epithelial compartment of prostate tissue(PMID:16166285).It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5062 Product name: Recombinant human ALDH1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-481 aa of BC030589 Sequence: GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS Predict reactive species\nFull Name: aldehyde dehydrogenase 1 family, member A2\nCalculated Molecular Weight: 518 aa, 57 kDa\nObserved Molecular Weight: 53-57 kDa\nGenBank Accession Number: BC030589\nGene Symbol: ALDH1A2\nGene ID (NCBI): 8854\nRRID: AB_2224033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94788\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910047401,"sku":"13951-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13951-1-ap","provider":"Iright","version":"1.0","type":"link"}