{"product_id":"proteintech-13981-1-ap","title":"Proteintech, 13981-1-AP, IGFBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGFBP1 (13981-1-AP) by Proteintech is a Polyclonal antibody targeting IGFBP1 in WB, IHC, ELISA applications with reactivity to human samples\n13981-1-AP targets IGFBP1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human placenta\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIGF-binding proteins (IGFBPs) family contains members like IGFBP-1, -2, -3, -4,-5 and-6. IGFBPs prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGF-I physically interacts with IGFBP-1 and that IGFBP-1 also binds to an integrin receptor, but the effect of IGFBP-1 on cell migration may be independent of IGF-I and is probably mediated through the alpha 5 beta 1 integrin. Transgenic mice models demonstrated that IGFBPs played important roles in the pathogenesis of obesity and INS resistance. Studies conducted in humans demonstrated the close relation between IGFBPs and the components of the metabolic syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5026 Product name: Recombinant human IGFBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-259 aa of BC057806 Sequence: GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Predict reactive species\nFull Name: IGF binding protein 1\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-35 kDa\nGenBank Accession Number: BC057806\nGene Symbol: IGFBP1\nGene ID (NCBI): 3484\nRRID: AB_2233481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08833\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868885012649,"sku":"13981-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13981-1-ap","provider":"Iright","version":"1.0","type":"link"}