{"product_id":"proteintech-13997-1-ap","title":"Proteintech, 13997-1-AP, Cryptochrome 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nCryptochrome 2 Polyclonal Antibody for WB, IHC, IF\/ICC, IP, ELISA\n13997-1-AP targets Cryptochrome 2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, Y79 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCryptochrome circadian clock 2 (CRY2) is a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. Loss of CRY2 stabilizes c-MYC and enhances cellular transformation. CRY2 can function as a co-factor for the SCF substrate adaptor FBXL3 (PMID: 27840026). CRY2 has two isoform with MW of 60 and 67 kDa. This antibody can recognize CRY1 and CRY2 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5085 Product name: Recombinant human CRY2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 243-593 aa of BC041814 Sequence: HLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA Predict reactive species\nFull Name: cryptochrome 2 (photolyase-like)\nCalculated Molecular Weight: 593 aa, 67 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC041814\nGene Symbol: CRY2\nGene ID (NCBI): 1408\nRRID: AB_10860100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q49AN0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849557673,"sku":"13997-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13997-1-ap","provider":"Iright","version":"1.0","type":"link"}