{"product_id":"proteintech-14013-1-ap","title":"Proteintech, 14013-1-AP, RARB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RARB (14013-1-AP) by Proteintech is a Polyclonal antibody targeting RARB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n14013-1-AP targets RARB in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Sp2\/0 cells\nPositive IHC detected in: mouse colon tissue, mouse bladder tissue,  human pancreas cancer tissue,  human renal cell carcinoma tissue,  mouse brain tissue,  rat bladder tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRetinoic acid receptors (RARs) are important mediators of retinoid signaling in morphogenesis, development, and cell differentiation. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PMID:12554770). They can bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, they act mainly as activators of gene expression due to weak binding to corepressors. RARB is one isotypes of RARs (PMID:12834868).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5119 Product name: Recombinant human RARB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-448 aa of BC060794 Sequence: EGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ Predict reactive species\nFull Name: retinoic acid receptor, beta\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 37-51 kDa\nGenBank Accession Number: BC060794\nGene Symbol: RARB\nGene ID (NCBI): 5915\nRRID: AB_2177765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10826\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869426602153,"sku":"14013-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14013-1-ap","provider":"Iright","version":"1.0","type":"link"}