{"product_id":"proteintech-14014-1-ap","title":"Proteintech, 14014-1-AP, NFKBIZ Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFKBIZ (14014-1-AP) by Proteintech is a Polyclonal antibody targeting NFKBIZ in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14014-1-AP targets NFKBIZ in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, THP-1 cells,  U-251 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFKBIZ, also named as NF-kappa-B inhibitor zeta, is a 718 amino acid protein, which contains 7 ANK repeats and is expressed at high levels in peripheral blood leukocytes and lung, at moderate levels in liver, placenta, and at low levels in spleen, kidney, skeletal muscle and heart. NFKBIZ exists as three isoforms and molecular weight of isoform three is a 64 kDa. The isoform one is 78 kDa protein and isoform two is a 68 kDa protein. NFKBIZ is involved in regulation of NF-kappa-B transcription factor complexes. It Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5120 Product name: Recombinant human NFKBIZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-718 aa of BC060800 Sequence: AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY Predict reactive species\nFull Name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta\nCalculated Molecular Weight: 78 kDa\nObserved Molecular Weight: 78 kDa, 64 kDa\nGenBank Accession Number: BC060800\nGene Symbol: NFKBIZ\nGene ID (NCBI): 64332\nRRID: AB_2878000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943306921,"sku":"14014-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14014-1-ap","provider":"Iright","version":"1.0","type":"link"}