{"product_id":"proteintech-14055-1-ap","title":"Proteintech, 14055-1-AP, USP16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP16 (14055-1-AP) by Proteintech is a Polyclonal antibody targeting USP16 in WB, IHC, IP, ELISA applications with reactivity to human samples\n14055-1-AP targets USP16 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver tissue, human brain tissue,  human spleen tissue,  human ovary tissue,  human kidney tissue,  human heart tissue,  human testis tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP16 (Ubiquitin specific peptidase 16) was originally identified as a DUB of histone H2A which is implicated in cell cycle progression and HOXD10 gene expression (PMID:17914355). The knockout study has reported that depletion of USP16 results in early embryonic lethality in mice (PMID:24784029). Moreover, USP16 mediated the deubiquitination and stabilization of Drp1 through its direct interaction with Drp1 (PMID:37488647).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4981 Product name: Recombinant human USP16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-386 aa of BC030777 Sequence: MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKHASITTPKPEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSL Predict reactive species\nFull Name: ubiquitin specific peptidase 16\nCalculated Molecular Weight: 94 kDa\nObserved Molecular Weight: 100-120 kDa\nGenBank Accession Number: BC030777\nGene Symbol: USP16\nGene ID (NCBI): 10600\nRRID: AB_2272832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5T5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991246505,"sku":"14055-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14055-1-ap","provider":"Iright","version":"1.0","type":"link"}