{"product_id":"proteintech-14063-1-ap","title":"Proteintech, 14063-1-AP, SETD8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SETD8 (14063-1-AP) by Proteintech is a Polyclonal antibody targeting SETD8 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14063-1-AP targets SETD8 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, RAW 264.7 cells,  HepG2 cells,  A549 cells,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSETD8, also known as Set8, PR-Set7, or KMT5A, is a member of the SET domain family of histone lysine methyltransferases and, to date, the only known enzyme that catalyzes monomethylation of H4K20 in eukaryotes, which is involved in DNA damage response, mitotic condensation, and DNA replication. SETD8 is overexpressed in various types of tumors, such as bladder cancer, non-small cell lung carcinoma, and small cell lung carcinoma, and is associated with a shorter survival time for gastric, esophageal, and prostate cancer patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5114 Product name: Recombinant human SETD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-352 aa of BC050346 Sequence: MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVRHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH Predict reactive species\nFull Name: SET domain containing (lysine methyltransferase) 8\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC050346\nGene Symbol: SETD8\nGene ID (NCBI): 387893\nRRID: AB_2878006\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQR1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868865089705,"sku":"14063-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14063-1-ap","provider":"Iright","version":"1.0","type":"link"}