{"product_id":"proteintech-14072-1-ap","title":"Proteintech, 14072-1-AP, ZNF354A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF354A (14072-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF354A in WB, ELISA applications with reactivity to human, mouse, rat samples\n14072-1-AP targets ZNF354A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF354A, also called EZNF, KID-1 or TCF17, belongs to the Kruppel C2H2-type zinc-finger family of proteins that contain KRAB domains and act as transcriptional regulators. Expressed primarily in the adult kidney, ZNF354A is a transcriptional repressor that plays a role in late renal development and is suppressed after renal ischemia. The N-terminus of ZNF354A contains the KRAB domain which confers transcriptional repressor activity, while the C-terminus contains multiple Cys2His2-zinc fingers. ZNF354A is located in the nucleolus and is thought to specifically influence development of the proximal tubule by shutting off dispensable or inhibitory genes. Reduced ZNF354A expression prevents proper cell differentiation and may, therefore, be implicated in renal carcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5142 Product name: Recombinant human ZNF354A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-605 aa of BC047105 Sequence: LIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYSCKECGKSFSRRSGLFIHQKIHAEENPCKYNPGRKASSCSTSLSGCQRIHSRKKSYLCNECGNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFTSISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQHRRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKIHIEEDP Predict reactive species\nFull Name: zinc finger protein 354A\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC047105\nGene Symbol: ZNF354A\nGene ID (NCBI): 6940\nRRID: AB_2217732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60765\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887947894953,"sku":"14072-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14072-1-ap","provider":"Iright","version":"1.0","type":"link"}