{"product_id":"proteintech-14081-1-ap","title":"Proteintech, 14081-1-AP, TSSK6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSSK6 (14081-1-AP) by Proteintech is a Polyclonal antibody targeting TSSK6 in WB, ELISA applications with reactivity to human, mouse, rat samples\n14081-1-AP targets TSSK6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSSK6 (testis-specific serine kinase 6) is a testis-specific protein kinase that is highly conserved in mammals and essential for spermatogenesis. In spermatozoa, TSSK6 is expressed after meiosis and is localized to the nucleus of spermatocytes and to the posterior part of the head of spermatocytes. TSSK6-deficient spermatozoa exhibit a defective histone-to-fischerin transition (required for chromatin remodeling after meiosis), as well as a reduction in actin polymerization in spermatocytes. The result is striking morphological defects in the spermatozoa, including nuclear malformations, a hairpin shape with the head facing backward, or complete separation of the head. In addition, Tssk6 is frequently aberrantly expressed in colorectal cancer and exhibits oncogenic activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5209 Product name: Recombinant human TSSK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC014611 Sequence: MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG Predict reactive species\nFull Name: testis-specific serine kinase 6\nCalculated Molecular Weight: 30.3 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC014611\nGene Symbol: TSSK6\nGene ID (NCBI): 83983\nRRID: AB_3669176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887909654697,"sku":"14081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14081-1-ap","provider":"Iright","version":"1.0","type":"link"}