{"product_id":"proteintech-14119-1-ap","title":"Proteintech, 14119-1-AP, MARCH8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARCH8 (14119-1-AP) by Proteintech is a Polyclonal antibody targeting MARCH8 in WB, IP, ELISA applications with reactivity to human, mouse samples\n14119-1-AP targets MARCH8 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARCH8 (Membrane-associated RING finger protein 8) is also named as MIR, RNF178 and belongs to the RING zinc finger protein family. It functions as an E3 ubiquitin ligase for immune recognition-related molecules (e.g. major histocompatibility complex class I, B7-2, and ICAM-1). It plays a key role in controlling MHC class II surface expression by regulated ubiquitination of a lysine residue in the beta-chain (PMID:22761441).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5268 Product name: Recombinant human MARCH8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC066988 Sequence: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCS Predict reactive species\nFull Name: membrane-associated ring finger (C3HC4) 8\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 30-33 kDa\nGenBank Accession Number: BC066988\nGene Symbol: MARCH8\nGene ID (NCBI): 220972\nRRID: AB_2140168\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T0T0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868859158697,"sku":"14119-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14119-1-ap","provider":"Iright","version":"1.0","type":"link"}