{"product_id":"proteintech-14125-1-ap","title":"Proteintech, 14125-1-AP, CDC26 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC26 (14125-1-AP) by Proteintech is a Polyclonal antibody targeting CDC26 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14125-1-AP targets CDC26 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDC26, also named as ANAPC12, APC12 and C9orf17, is a component of the anaphase promoting complex\/cyclosome (APC\/C). CDC26 can be detected as 14 kDa and ~18 kDa (PMID: 15060174 \/PMID: 10222126).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5276 Product name: Recombinant human CDC26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC066300 Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF Predict reactive species\nFull Name: cell division cycle 26 homolog (S. cerevisiae)\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC066300\nGene Symbol: CDC26\nGene ID (NCBI): 246184\nRRID: AB_2878018\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NHZ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869523529897,"sku":"14125-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14125-1-ap","provider":"Iright","version":"1.0","type":"link"}