{"product_id":"proteintech-14162-1-ap","title":"Proteintech, 14162-1-AP, HVCN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HVCN1 (14162-1-AP) by Proteintech is a Polyclonal antibody targeting HVCN1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14162-1-AP targets HVCN1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells,  PC-3 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHVCN1, also named as VSOP and HV1, Belongs to the hydrogen channel family. HVCN1 mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, HVCN1 is accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis. HVCN1, the voltage-sensitive proton channel, is present in human sperm and is an important regulator of the functional maturation of sperm. HVCN1 has four isoforms with MW 28-32 kDa or 40 kDa (modification). It has a dimer form with MW ~60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5350 Product name: Recombinant human HVCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC032672 Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQV Predict reactive species\nFull Name: hydrogen voltage-gated channel 1\nCalculated Molecular Weight: 273 aa, 32 kDa\nObserved Molecular Weight: 28-32 kDa, ~60 kDa\nGenBank Accession Number: BC032672\nGene Symbol: HVCN1\nGene ID (NCBI): 84329\nRRID: AB_2878023\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96D96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869695922345,"sku":"14162-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14162-1-ap","provider":"Iright","version":"1.0","type":"link"}