{"product_id":"proteintech-14186-1-ap","title":"Proteintech, 14186-1-AP, UPP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UPP1 (14186-1-AP) by Proteintech is a Polyclonal antibody targeting UPP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14186-1-AP targets UPP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, SGC-7901 cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUridine phosphorylase 1 (UPP1) belongs to the purine\/pyrimidine phosphorylase family. It is an enzyme that catalyzes the reversible conversion of uridine to uracil and ribose-1-phosphate. UPP1 plays a crucial role in pyrimidine metabolism. UPP1 is highly expressed in various cancers, aiding in metabolic reprogramming, tumor growth, and immune evasion. The apparent molecular mass measured by SDS-PAGE is 34 kDa. The post-translational modification of UPP1 is primarily ubiquitination.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5441 Product name: Recombinant human UPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC047030 Sequence: MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA Predict reactive species\nFull Name: uridine phosphorylase 1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC047030\nGene Symbol: UPP1\nGene ID (NCBI): 7378\nRRID: AB_2878025\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16831\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991180969,"sku":"14186-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14186-1-ap","provider":"Iright","version":"1.0","type":"link"}