{"product_id":"proteintech-14192-1-ap","title":"Proteintech, 14192-1-AP, HSD11B2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSD11B2 (14192-1-AP) by Proteintech is a Polyclonal antibody targeting HSD11B2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14192-1-AP targets HSD11B2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, mouse kidney tissue,  human kidney tissue,  Transfected HEK-293 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe HSD11B2 gene encodes the type II isoform of 11-beta-hydroxysteroid dehydrogenase, a microsomal enzyme complex responsible for the interconversion of biologically active cortisol and inactive cortisone. This protein catalyzes the cortisol-to-cortisone reaction. This protein expresses approximately 44 kDa in placenta, trophoblast, and distal colon, but in kidney tissue, there are two bands of approximately 44 and 48 kDa can be consistently observed and no signal is seen in decidua, adrenal, or liver(PMID:9048640). HSD11B2 protein was detected in CEM-C7 cells via immunoblot analysis as a dimer and trimer of approximately 80 and 120 kDa (PMID:23762608).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5146 Product name: Recombinant human HSD11B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-405 aa of BC036780 Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR Predict reactive species\nFull Name: hydroxysteroid (11-beta) dehydrogenase 2\nCalculated Molecular Weight: 405 aa, 44 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: BC036780\nGene Symbol: HSD11B2\nGene ID (NCBI): 3291\nRRID: AB_2119643\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P80365\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876558505,"sku":"14192-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14192-1-ap","provider":"Iright","version":"1.0","type":"link"}