{"product_id":"proteintech-14207-1-ap","title":"Proteintech, 14207-1-AP, MREG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MREG (14207-1-AP) by Proteintech is a Polyclonal antibody targeting MREG in WB, ELISA applications with reactivity to human samples\n14207-1-AP targets MREG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMREG, also known as DSU, belongs to the melanoregulin family. MREG is a small, highly charged protein thought to play a role in organelle biogenesis due to its effect on pigmentation in dilute, ashen, and leaden mutant mice (PMID: 19240024). Additionally, MREG probably functions as a cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery. MREG has 2 isoforms with the molecular weights of 25 and 26 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5416 Product name: Recombinant human MREG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-214 aa of BC032747 Sequence: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP Predict reactive species\nFull Name: melanoregulin\nCalculated Molecular Weight: 25kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC032747\nGene Symbol: MREG\nGene ID (NCBI): 55686\nRRID: AB_3085432\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N565\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887723892905,"sku":"14207-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14207-1-ap","provider":"Iright","version":"1.0","type":"link"}