{"product_id":"proteintech-14212-1-ap","title":"Proteintech, 14212-1-AP, KChIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KChIP1 (14212-1-AP) by Proteintech is a Polyclonal antibody targeting KChIP1 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human samples\n14212-1-AP targets KChIP1 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human cerebellum tissue,  human brain tissue\nPositive IP detected in: fetal human brain tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman K(v) channel interacting protein 1 (KCHIP1) is a new member of the neural calcium binding protein superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. KChIP1 is a neuronal calcium sensor protein that is predominantly expressed at GABAergic synapses and it has been related with modulation of K(+) channels, GABAergic transmission and cell death.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5432 Product name: Recombinant human KCNIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC050375 Sequence: MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM Predict reactive species\nFull Name: Kv channel interacting protein 1\nCalculated Molecular Weight: 227 aa, 27 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC050375\nGene Symbol: KCNIP1\nGene ID (NCBI): 30820\nRRID: AB_2265412\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZI2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887690666153,"sku":"14212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14212-1-ap","provider":"Iright","version":"1.0","type":"link"}