{"product_id":"proteintech-14219-1-ap","title":"Proteintech, 14219-1-AP, MTIF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTIF3 (14219-1-AP) by Proteintech is a Polyclonal antibody targeting MTIF3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n14219-1-AP targets MTIF3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human preadipocyte cells,  HT-29 cells,  HeLa cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver tissue, mouse testis tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTIF3, also named as DC38, belongs to the IF-3 family. MTIF3 encodes a 29 kDa protein that promotes formation of the initiation complex on the mitochondrial 55S ribosome, thereby playing an active role in initiation of translation. Like bacterial IF3, MTIF3 is believed to bind first to the small mitoribosomal subunit to keep it dissociated from the large subunit during initiation. After binding of MTIF3, mRNA and formylated initiator methionyl-tRNA (fMet-tRNAifMet) bind to the small mitoribosomal subunit. The large subunit then joins the small subunit to form an elongation-competent ribosome (PMID:20887776, 31350787).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5457 Product name: Recombinant human MTIF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-278 aa of BC046166 Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ Predict reactive species\nFull Name: mitochondrial translational initiation factor 3\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC046166\nGene Symbol: MTIF3\nGene ID (NCBI): 219402\nRRID: AB_10638621\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2K0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943044777,"sku":"14219-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14219-1-ap","provider":"Iright","version":"1.0","type":"link"}