{"product_id":"proteintech-14232-1-ap","title":"Proteintech, 14232-1-AP, Kallikrein 8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kallikrein 8 (14232-1-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14232-1-AP targets Kallikrein 8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLK8(Kallikrein-8) is also named as NRPN, PRSS19, TADG14.It is a new member of the human kallikrein family, which is predicted to be secreted and expected to be present in biological fluids (PMID:12507964).The protein is detectable in ovarian cancer tissue extracts, serum, and ascites fluid, indicating that it may serve as a new ovarian cancer marker (PMID:12782581). KLK8 has one predicted glycosylation site (PMID:20940292) and it has some isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5472 Product name: Recombinant human KLK8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC040887 Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG Predict reactive species\nFull Name: kallikrein-related peptidase 8\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC040887\nGene Symbol: KLK8\nGene ID (NCBI): 11202\nRRID: AB_2134643\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60259\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869699821737,"sku":"14232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14232-1-ap","provider":"Iright","version":"1.0","type":"link"}