{"product_id":"proteintech-14298-1-ap","title":"Proteintech, 14298-1-AP, CHST15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHST15 (14298-1-AP) by Proteintech is a Polyclonal antibody targeting CHST15 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n14298-1-AP targets CHST15 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse spleen tissue,  Raji cells,  U-937 cells,  mouse heart tissue,  rat heart tissue\nPositive IP detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarbohydrate sulfotransferase 15, also known as CHST15, BRAG, GALNAC4S6ST and KIAA0598, is a single-pass type II membrane protein which belongs to the sulfotransferase 1 family. CHST15 is a sulfotransferase that transfers sulfate from  3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO4) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. CHST15 may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and \/ or regulation of B-cell-specific RAG expression. CHST15 is expressed in B-cell-enriched tissues but not in fetal or adult thymus. It is expressed in fetal and adult spleen, lymph node, tonsil, bone marrow and peripheral leukocytes. It can be detected as 49 kDa and 69 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5679 Product name: Recombinant human CHST15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-451 aa of BC050540 Sequence: QELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVC Predict reactive species\nFull Name: carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 49 kDa, 69 kDa\nGenBank Accession Number: BC050540\nGene Symbol: CHST15\nGene ID (NCBI): 51363\nRRID: AB_2081161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7LFX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995408041,"sku":"14298-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14298-1-ap","provider":"Iright","version":"1.0","type":"link"}