{"product_id":"proteintech-14327-1-ap","title":"Proteintech, 14327-1-AP, PGT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGT (14327-1-AP) by Proteintech is a Polyclonal antibody targeting PGT in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14327-1-AP targets PGT in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, NIH\/3T3 cells,  mouse liver tissue,  rat kidney tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProstaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and\/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and\/ or metabolic clearance of PG in diverse tissues (8787677). This antibody is expected to detect the endogenous PGT protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5594 Product name: Recombinant human PGT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 422-643 aa of BC041140 Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 2A1\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC041140\nGene Symbol: PGT\nGene ID (NCBI): 6578\nRRID: AB_2270464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92959\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869482963113,"sku":"14327-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14327-1-ap","provider":"Iright","version":"1.0","type":"link"}