{"product_id":"proteintech-14355-1-ap","title":"Proteintech, 14355-1-AP, ST6GAL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ST6GAL1 (14355-1-AP) by Proteintech is a Polyclonal antibody targeting ST6GAL1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n14355-1-AP targets ST6GAL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HuH-7 cells,  Jurkat cells,  mouse spleen tissue,  U-937 cells,  L02 cells\nPositive IP detected in: Raji cells\nPositive IHC detected in: human colon cancer tissue, human ovary cancer tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Western blot analysis of human liver using this antibody detects both isoforms between 43-50 kDa. Higher molecular weight of bands around 50-70 kDa can also be observed with glycosylation modification. (PMID: 15049997, 23358684)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5705 Product name: Recombinant human ST6GAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-406 aa of BC040009 Sequence: SQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC Predict reactive species\nFull Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 1\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 43-45 kDa, 50-70 kDa\nGenBank Accession Number: BC040009\nGene Symbol: ST6GAL1\nGene ID (NCBI): 6480\nRRID: AB_2194422\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15907\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908802217,"sku":"14355-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14355-1-ap","provider":"Iright","version":"1.0","type":"link"}