{"product_id":"proteintech-14365-1-ap","title":"Proteintech, 14365-1-AP, VAP1\/AOC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAP1\/AOC3 (14365-1-AP) by Proteintech is a Polyclonal antibody targeting VAP1\/AOC3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14365-1-AP targets VAP1\/AOC3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse adipose tissue,  rat lung tissue,  mouse stomach tissue\nPositive IHC detected in: human appendicitis tissue, human lung cancer tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAOC3(membrane primary amine oxidase) is also name as copper amine oxidase, HPAO, SSAO, VAP1 and belongs to the copper\/topaquinone oxidase family. It is expressed on the surface of endothelial cells and is involved in leukocyte trafficking between blood and tissues under physiologic and pathologic conditions (PMID:17947691). AOC3 is highly expressed in adipocytes and smooth muscle cells and it can be N- and O-glycosylated (PMID:16046623). AOC3 has molecular mass of 70-90kD, and can exsit as a homodimer(165-185kD) and trimer(240~260kD) (PMID:10595925, 8625974).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5683 Product name: Recombinant human AOC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 408-763 aa of BC050549 Sequence: ATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN Predict reactive species\nFull Name: amine oxidase, copper containing 3 (vascular adhesion protein 1)\nCalculated Molecular Weight: 85 kDa\nObserved Molecular Weight: 85-90 kDa\nGenBank Accession Number: BC050549\nGene Symbol: AOC3\nGene ID (NCBI): 8639\nRRID: AB_2058043\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16853\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869792030889,"sku":"14365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14365-1-ap","provider":"Iright","version":"1.0","type":"link"}