{"product_id":"proteintech-14384-1-ap","title":"Proteintech, 14384-1-AP, Fascin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fascin (14384-1-AP) by Proteintech is a Polyclonal antibody targeting Fascin in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples\n14384-1-AP targets Fascin in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse thymus tissue,  K-562 cells,  NIH\/3T3 cells,  SH-SY5Y cells,  SK-N-SH cells\nPositive IHC detected in: human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: U-87 MG cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5816 Product name: Recombinant human Fascin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS Predict reactive species\nFull Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC000521\nGene Symbol: Fascin\nGene ID (NCBI): 6624\nENSEMBL Gene ID: ENSG00000075618\nRRID: AB_2106381\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16658\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906049705,"sku":"14384-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14384-1-ap","provider":"Iright","version":"1.0","type":"link"}