{"product_id":"proteintech-14416-1-ap","title":"Proteintech, 14416-1-AP, MOCS2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOCS2B (14416-1-AP) by Proteintech is a Polyclonal antibody targeting MOCS2B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14416-1-AP targets MOCS2B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse heart tissue,  Jurkat cells\nPositive IHC detected in: rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMOCS2(Molybdenum cofactor synthesis 2) is a heterotetrameric synthase comprised of 2 small (MOCS2A) and 2 large (MOCS2B) subunits. MOCS2 acts as a sulfur carrier required for molybdopterin biosynthesis. The two MOCS2 proteins A and B are subunits of molybdopterin synthase incorporating sulfur groups delivered by the MOCS3 sulfurylase.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5761 Product name: Recombinant human MOCS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC046097 Sequence: MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS Predict reactive species\nFull Name: molybdenum cofactor synthesis 2\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC046097\nGene Symbol: MOCS2\nGene ID (NCBI): 4338\nRRID: AB_2250779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O96007\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887721795753,"sku":"14416-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14416-1-ap","provider":"Iright","version":"1.0","type":"link"}