{"product_id":"proteintech-14437-1-ap","title":"Proteintech, 14437-1-AP, TMPRSS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMPRSS2 (14437-1-AP) by Proteintech is a Polyclonal antibody targeting TMPRSS2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n14437-1-AP targets TMPRSS2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, Caco-2 cells,  T-47D cells\nPositive IHC detected in: human colon cancer tissue, human prostate cancer tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMPRSS2, also named as PRSS10, is a type II transmembrane serine protease which is highly expressed by the epithelium of the human prostate gland. TMPRSS2 may contribute to prostate tumour metastasis via the activation of PAR-2. TMPRSS2 is a Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions. TMPRSS2 is a host cell factor that is critical for the spread of several clinically relevant viruses, including influenza A viruses and coronaviruses (PMID: 23468491, 30626688). SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. The initial spike protein priming by TMPRSS2 is essential for the entry and viral spread of SARS-CoV-2 through interaction with the ACE2 receptor (PMID: 32142651, 30626688 ). Camostat mesylate, an inhibitor of TMPRSS2, can block SARS-CoV-2 infection of lung cells (PMID: 32142651). The MW of TMPRSS2 is about 65-70 kDa. It can be cleaved into some chains with MW 54 kDa, 31 kDa and 26 kDa (PMID: 25734995, 20382709, 26018085).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5824 Product name: Recombinant human TMPRSS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 108-492 aa of BC051839 Sequence: FMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Predict reactive species\nFull Name: transmembrane protease, serine 2\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 70, 54, 31 kDa\nGenBank Accession Number: BC051839\nGene Symbol: TMPRSS2\nGene ID (NCBI): 7113\nRRID: AB_2878058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15393\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853751977,"sku":"14437-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14437-1-ap","provider":"Iright","version":"1.0","type":"link"}