{"product_id":"proteintech-14511-1-ap","title":"Proteintech, 14511-1-AP, Synaptotagmin-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Synaptotagmin-1 (14511-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14511-1-AP targets Synaptotagmin-1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, HCT 116 cells,  mouse testis tissue,  human liver tissue,  Y79 cells\nPositive IP detected in: mouse cerebellum tissue, HCT 116 cells\nPositive IHC detected in: rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:4000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5970 Product name: Recombinant human SYT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-422 aa of BC058917 Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK Predict reactive species\nFull Name: synaptotagmin I\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 65 kDa, 47 kDa\nGenBank Accession Number: BC058917\nGene Symbol: Synaptotagmin-1\nGene ID (NCBI): 6857\nRRID: AB_2199166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21579\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868870332585,"sku":"14511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14511-1-ap","provider":"Iright","version":"1.0","type":"link"}