{"product_id":"proteintech-14551-1-ap","title":"Proteintech, 14551-1-AP, NAC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NAC1 (14551-1-AP) by Proteintech is a Polyclonal antibody targeting NAC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14551-1-AP targets NAC1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, MCF-7 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: mouse ovary tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNACC1, also named as BTBD14B and NAC1, belongs to the BTB\/POZ family. NACC1 is a transcriptional repressor, which is amplified and overexpressed in various human cancers and plays critical roles in tumor development, progression, and drug resistance (PMID: 31101655). NACC1 has 1 isoform with the molecular mass of 57 kDa. While NAC1 has been shown to repress the transcription of two tumor suppressors, Gadd45-g and Gadd45-g- interacting protein 1, scientists have found that NACC1 also plays an important role in nontranscriptional function, for example, it can act as a bridge for MAVS and TBK1 in RLR-mediated signaling (PMID: 31235549).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6096 Product name: Recombinant human NACC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 173-527 aa of BC055396 Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ Predict reactive species\nFull Name: nucleus accumbens associated 1, BEN and BTB (POZ) domain containing\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC055396\nGene Symbol: NACC1\nGene ID (NCBI): 112939\nRRID: AB_2918036\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RE7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869475459241,"sku":"14551-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14551-1-ap","provider":"Iright","version":"1.0","type":"link"}