{"product_id":"proteintech-14563-1-ap","title":"Proteintech, 14563-1-AP, CDR2L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDR2L (14563-1-AP) by Proteintech is a Polyclonal antibody targeting CDR2L in IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14563-1-AP targets CDR2L in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: human cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCerebellar degeneration-related protein 2-like(CDR2L), also named as HUMPPA or Paraneoplastic 62 kDa antigen, is a 465 amino acid protein, which belongs to the CDR2 family. CDR2L contains three potential coiled-coil regions. The functions of protein is so far not known. CDR2L is expressed in the brain and localizes in the cytoplasm. The predicted MW of this protein is 53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6127 Product name: Recombinant human CDR2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-459 aa of BC047534 Sequence: TETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK Predict reactive species\nFull Name: cerebellar degeneration-related protein 2-like\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC047534\nGene Symbol: CDR2L\nGene ID (NCBI): 30850\nRRID: AB_2076740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86X02\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978172073,"sku":"14563-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14563-1-ap","provider":"Iright","version":"1.0","type":"link"}