{"product_id":"proteintech-14596-1-ap","title":"Proteintech, 14596-1-AP, BRN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRN2 (14596-1-AP) by Proteintech is a Polyclonal antibody targeting BRN2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n14596-1-AP targets BRN2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IHC detected in: mouse brain tissue, human gliomas tissue,  human placenta tissue,  human skin tissue,  human spleen tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue, human gliomas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. It shares a highly homologous region that referred to as the POU domain. POU3F2 is a Class III POU genes that expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. POU3F2 is required for maintaining neural cell differetiation and has a role in the production and positioning of neocortical neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6131 Product name: Recombinant human POU3F2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-443 aa of BC051699 Sequence: SMGASNGGLLYSQPSFTVNGMLGAGGQSAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ Predict reactive species\nFull Name: POU class 3 homeobox 2\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC051699\nGene Symbol: BRN2\nGene ID (NCBI): 5454\nRRID: AB_2167371\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20265\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993573033,"sku":"14596-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14596-1-ap","provider":"Iright","version":"1.0","type":"link"}