{"product_id":"proteintech-14605-1-ap","title":"Proteintech, 14605-1-AP, DNM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNM2 (14605-1-AP) by Proteintech is a Polyclonal antibody targeting DNM2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n14605-1-AP targets DNM2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  Jurkat cells,  NIH\/3T3 cells,  human brain tissue,  MDA-MB-231 cells,  human peripheral blood platelets,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNM2, also known as DYN2, DYNII, CMTDI1, CMTDIB, belongs to the dynamin family. DNM2 is a ubiquitously expressed large GTPase involved in clathrin-dependent and -independent endocytosis and intracellular membrane trafficking. DNM2 plays a role in the regulation of neuron morphology, axon growth, and the formation of neuronal growth cones. Dynamins are associated with microtubules. DNM2 plays an important role in endocytosis and is involved in cytokinesis (PMID: 33713620, 12498685). Mutations in DNM2 cause dominant centronuclear myopathy (PMID: 16227997). Defects in DNM2 are the cause of Charcot-Marie-Tooth disease dominant intermediate type B (CMTDIB) (PMID: 15731758). Alternate splicing results in multiple transcript variants.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6156 Product name: Recombinant human DNM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 518-866 aa of BC054501 Sequence: RRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD Predict reactive species\nFull Name: dynamin 2\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC054501\nGene Symbol: DNM2\nGene ID (NCBI): 1785\nRRID: AB_2277414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50570\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868965294249,"sku":"14605-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14605-1-ap","provider":"Iright","version":"1.0","type":"link"}