{"product_id":"proteintech-14619-1-ap","title":"Proteintech, 14619-1-AP, NMUR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NMUR1 (14619-1-AP) by Proteintech is a Polyclonal antibody targeting NMUR1 in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n14619-1-AP targets NMUR1 in WB, IHC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human colon tissue,  human stomach tissue,  mouse pancreas tissue\nPositive IHC detected in: mouse brain tissue, human colon tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuromedin-U (NMU) is a widely expressed peptide with the highest abundance in the central nervous system (CNS) and intestinal tract of nearly all vertebrate species. NMU mediates several physiological functions via its two cognate receptors, NMUR1 and NMUR2 (PMID:37102164). NMUR1(NmU receptor 1) has the highest expression in peripheral tissues, particularly the GI tract, pancreas, uterus, and testes but has also been reported in peripheral nerve terminals (PMID:10783389).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6235 Product name: Recombinant human NMUR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-426 aa of BC036543 Sequence: YEMWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIQQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS Predict reactive species\nFull Name: neuromedin U receptor 1\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC036543\nGene Symbol: NMUR1\nGene ID (NCBI): 10316\nRRID: AB_2267310\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HB89\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887739457705,"sku":"14619-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14619-1-ap","provider":"Iright","version":"1.0","type":"link"}