{"product_id":"proteintech-14643-1-ap","title":"Proteintech, 14643-1-AP, REEP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REEP5 (14643-1-AP) by Proteintech is a Polyclonal antibody targeting REEP5 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n14643-1-AP targets REEP5 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  rat heart tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nREEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1 or TB2, is a membrane protein belonging to DP1\/Yop1p protein family. All REEP proteins contain a conserved TB2\/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of ER network (PMID: 19665976).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey, xenopus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6229 Product name: Recombinant human REEP5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-189 aa of BC065926 Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST Predict reactive species\nFull Name: receptor accessory protein 5\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 18-21 kDa\nGenBank Accession Number: BC065926\nGene Symbol: REEP5\nGene ID (NCBI): 7905\nRRID: AB_2178440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00765\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840284329,"sku":"14643-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14643-1-ap","provider":"Iright","version":"1.0","type":"link"}