{"product_id":"proteintech-14660-1-ap","title":"Proteintech, 14660-1-AP, RPL37A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nRPL37A Polyclonal Antibody for WB, IHC, IF\/ICC, FC (Intra), IP, ELISA\n14660-1-AP targets RPL37A in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  MCF-7 cells,  SH-SY5Y cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6330 Product name: Recombinant human RPL37A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC063476 Sequence: MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYK Predict reactive species\nFull Name: ribosomal protein L37a\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC063476\nGene Symbol: RPL37A\nGene ID (NCBI): 6168\nRRID: AB_2238668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61513\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009432745,"sku":"14660-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14660-1-ap","provider":"Iright","version":"1.0","type":"link"}