{"product_id":"proteintech-14689-1-ap","title":"Proteintech, 14689-1-AP, DIS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIS3 (14689-1-AP) by Proteintech is a Polyclonal antibody targeting DIS3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14689-1-AP targets DIS3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse ovary tissue,  mouse testis tissue,  HeLa cells,  Jurkat cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDIS3, also named as KIAA1008 and RRP44, belongs to the ribonuclease II (RNB) family. It is a component of the exosome 3'-\u0026gt;5' exoribonuclease complex. DIS3 is required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. It is also associated with the GTPase Ran. DIS3 has a 3'-5' exonuclease activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, drosophila\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6117 Product name: Recombinant human DIS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 607-958 aa of BC056143 Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK Predict reactive species\nFull Name: DIS3 mitotic control homolog (S. cerevisiae)\nCalculated Molecular Weight: 109 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC056143\nGene Symbol: DIS3\nGene ID (NCBI): 22894\nRRID: AB_2091025\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2L1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893401257,"sku":"14689-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14689-1-ap","provider":"Iright","version":"1.0","type":"link"}