{"product_id":"proteintech-14714-1-ap","title":"Proteintech, 14714-1-AP, NF45 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NF45 (14714-1-AP) by Proteintech is a Polyclonal antibody targeting NF45 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14714-1-AP targets NF45 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse brain tissue,  NIH\/3T3 cells,  Jurkat cells,  rat brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-2 enhancer binding factor 2 (ILF2), also named as nuclear factor 45 (NF45), plays important roles in regulating interleukin-2 expression in mammals. It forms a heterodimeric complex with ILF3, which may regulate transcription of the IL2 gene during T-cell activation. It can also promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA [PMID:11739746,17129403].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6436 Product name: Recombinant human NF45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-390 aa of BC000382 Sequence: EVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE Predict reactive species\nFull Name: interleukin enhancer binding factor 2, 45kDa\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43-45 kDa\nGenBank Accession Number: BC000382\nGene Symbol: ILF2\nGene ID (NCBI): 3608\nRRID: AB_2280445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12905\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868935180457,"sku":"14714-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14714-1-ap","provider":"Iright","version":"1.0","type":"link"}