{"product_id":"proteintech-14723-1-ap","title":"Proteintech, 14723-1-AP, GOLGA7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GOLGA7 (14723-1-AP) by Proteintech is a Polyclonal antibody targeting GOLGA7 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14723-1-AP targets GOLGA7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HL-60 cells,  HepG2 cells\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGOLGA7 (Golgin subfamily A member 7) is an acylated Golgi protein that interacts with GCP170 protein (PMID: 14522980). The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. The ZDHHC5-GOLGA7 protein acyltransferase complex promotes nonapoptotic cell death (PMID: 31631010).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6460 Product name: Recombinant human GOLGA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC012032 Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR Predict reactive species\nFull Name: golgi autoantigen, golgin subfamily a, 7\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC012032\nGene Symbol: GOLGA7\nGene ID (NCBI): 51125\nRRID: AB_3085440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z5G4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887654490281,"sku":"14723-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14723-1-ap","provider":"Iright","version":"1.0","type":"link"}