{"product_id":"proteintech-14732-1-ap","title":"Proteintech, 14732-1-AP, hD53; TPD52L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe hD53; TPD52L1 (14732-1-AP) by Proteintech is a Polyclonal antibody targeting hD53; TPD52L1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14732-1-AP targets hD53; TPD52L1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells, MCF-7 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor protein D52-like 1 (TPD52L1) gene, also known as hD53, encodes a member of the tumor protein D52 (TPD52) family. TPD52-like proteins are coiled-coil motif-bearing proteins first identified through their expression in human breast carcinoma, which have been proposed to represent signaling intermediates and regulators of vesicle trafficking. hD53 may form homo- or heterodimers with other TPD52 family members, and it is reported to be involved in cell proliferation and calcium signaling. Four variants resulted from alternative splicing have been predicated and this antibody is expected to recognize all the variants.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6493 Product name: Recombinant human hD53; TPD52L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC002375 Sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRK Predict reactive species\nFull Name: tumor protein D52-like 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC002375\nGene Symbol: TPD52L1\nGene ID (NCBI): 7164\nRRID: AB_2272159\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16890\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868981350569,"sku":"14732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14732-1-ap","provider":"Iright","version":"1.0","type":"link"}