{"product_id":"proteintech-14747-1-ap","title":"Proteintech, 14747-1-AP, SDF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SDF2 (14747-1-AP) by Proteintech is a Polyclonal antibody targeting SDF2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14747-1-AP targets SDF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HUVEC cells,  mouse heart,  U2OS cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSDF-2 is a small protein of 211 amino acids that is ubiquitously expressed in lung, breast, colon, liver and kidney. SDF-2 is localized in the ER and has been reported to get involved in multiple endoplasmic reticulum (ER) functions, including the misfolded protein catabolic process, protein glycosylation, and ER protein quality control.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6480 Product name: Recombinant human SDF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-211 aa of BC000500 Sequence: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL Predict reactive species\nFull Name: stromal cell-derived factor 2\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC000500\nGene Symbol: SDF2\nGene ID (NCBI): 6388\nRRID: AB_2918037\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99470\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887794868393,"sku":"14747-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14747-1-ap","provider":"Iright","version":"1.0","type":"link"}