{"product_id":"proteintech-14754-1-ap","title":"Proteintech, 14754-1-AP, COMT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COMT (14754-1-AP) by Proteintech is a Polyclonal antibody targeting COMT in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n14754-1-AP targets COMT in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  K-562 cells,  human placenta,  mouse liver,  rat liver\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human liver tissue, human placenta tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCatechol O-methyltransferase (COMT) is an important enzyme that catalyzes O-methylation and inactivation of metabolically active catechol-containing bioactive molecules and drugs. The mammalian COMT enzyme exists in soluble form (24-26 kDa) and membrane-bound form (28-30 kDa), which are encoded by a single gene utilizing different promoters.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6502 Product name: Recombinant human COMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC000419 Sequence: MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP Predict reactive species\nFull Name: catechol-O-methyltransferase\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC000419\nGene Symbol: COMT\nGene ID (NCBI): 1312\nRRID: AB_2083706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21964\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893171881,"sku":"14754-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14754-1-ap","provider":"Iright","version":"1.0","type":"link"}