{"product_id":"proteintech-14781-1-ap","title":"Proteintech, 14781-1-AP, ERLIN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERLIN2 (14781-1-AP) by Proteintech is a Polyclonal antibody targeting ERLIN2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14781-1-AP targets ERLIN2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERLIN2, also named as C8orf2 and SPFH2, is a component of the ERLIN1\/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs) such as ITPR1 (PubMed:19240031, PubMed:17502376). It promotes sterol-accelerated ERAD of HMGCR probably implicating an AMFR\/gp78-containing ubiquitin ligase complex (PubMed:21343306). ERLIN2 is involved in regulation of cellular cholesterol homeostasis by regulation the SREBP signaling pathway. The MW of ERLIN1\/ERLIN2 complex is about 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6369 Product name: Recombinant human ERLIN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-206 aa of BC067765 Sequence: VHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFGKKVSPEHAVLKQGSWNPASLHCLKPGCLQGVMVTYGQEMLKNLVLRSWSQRSSWRMLIAMQQDP Predict reactive species\nFull Name: ER lipid raft associated 2\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC067765\nGene Symbol: ERLIN2\nGene ID (NCBI): 11160\nRRID: AB_2098859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94905\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869459632297,"sku":"14781-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14781-1-ap","provider":"Iright","version":"1.0","type":"link"}