{"product_id":"proteintech-14789-1-ap","title":"Proteintech, 14789-1-AP, SNRPD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPD2 (14789-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD2 in WB, IHC, ELISA applications with reactivity to human samples\n14789-1-AP targets SNRPD2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells,  A549 cells,  HL-60 cells\nPositive IHC detected in: human skin tissue, human lung cancer tissue,  human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSystemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing,  snRNP biogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6443 Product name: Recombinant human SNRPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000486 Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Predict reactive species\nFull Name: small nuclear ribonucleoprotein D2 polypeptide 16.5kDa\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14-16 kDa\nGenBank Accession Number: BC000486\nGene Symbol: SNRPD2\nGene ID (NCBI): 6633\nRRID: AB_10898359\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62316\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869768798377,"sku":"14789-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14789-1-ap","provider":"Iright","version":"1.0","type":"link"}