{"product_id":"proteintech-14793-1-ap","title":"Proteintech, 14793-1-AP, UQCR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UQCR (14793-1-AP) by Proteintech is a Polyclonal antibody targeting UQCR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14793-1-AP targets UQCR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6491 Product name: Recombinant human UQCR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC000462 Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN Predict reactive species\nFull Name: ubiquinol-cytochrome c reductase, 6.4kDa subunit\nCalculated Molecular Weight: 6 kDa\nObserved Molecular Weight: 6 kDa\nGenBank Accession Number: BC000462\nGene Symbol: UQCR\nGene ID (NCBI): 10975\nRRID: AB_1557751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14957\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869626028201,"sku":"14793-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14793-1-ap","provider":"Iright","version":"1.0","type":"link"}