{"product_id":"proteintech-14800-1-ap","title":"Proteintech, 14800-1-AP, GOT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GOT2 (14800-1-AP) by Proteintech is a Polyclonal antibody targeting GOT2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n14800-1-AP targets GOT2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  mouse heart tissue,  mouse spleen tissue,  HEK-293 cells,  mouse brain,  rat brain\nPositive IHC detected in: human breast cancer tissue, human skin tissue,  rat brain tissue,  human liver tissue,  rat heart tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGOT2 encodes the mitochondrial glutamate oxaloacetate transaminase and plays an essential role in the intracellular NAD(H) redox balance. Upregulation of GOT2 has been reported in various cancers, including breast cancer and pancreatic cancer. GOT2 mutation leads to autosomal recessive neurometabolic disorder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6514 Product name: Recombinant human GOT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-430 aa of BC000525 Sequence: KAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK Predict reactive species\nFull Name: glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 43-45 kDa\nGenBank Accession Number: BC000525\nGene Symbol: GOT2\nGene ID (NCBI): 2806\nRRID: AB_2247898\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00505\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851589289,"sku":"14800-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14800-1-ap","provider":"Iright","version":"1.0","type":"link"}